PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P28360_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 900aa    MW: 98478.4 Da    PI: 6.4694
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P28360_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-182482357
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           k  ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr4P28360_001 24 KYVRYTPEQVEALERVYSECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 82
                           5678*****************************************************97 PP

2START168.35.4e-532164242205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++ g a+ra+g+v  +++  v+e+l+d++ W ++++  ++l vi +g 
  GSMUA_Achr4P28360_001 216 IAEETLAEFLSKATGTAVEWVQMVGMKPGPDSIGIVAVSHNCGGVAARACGLVSLEPT-KVAEVLKDRPSWYRDCRCLDVLTVIPTGn 302
                            68999*****************************************************.9999999999******************* PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g ++l++++++a+++l++ Rdf+++Ry+  l++g++vi+++S+++ +  p+     ++vRae+l Sg+li+p+++g+s +++v+hvd
  GSMUA_Achr4P28360_001 303 gGNIELTYMQTYAPTTLAAaRDFWTLRYTTALEDGSLVICERSLTPATGGPTgpaATNFVRAEMLSSGYLIRPCEGGGSMIHIVDHVD 390
                            ***************************************************999999******************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l+ ++++++lr+l++s  + ++kt+ a+l+++++
  GSMUA_Achr4P28360_001 391 LDPWSVPEVLRPLYESPKILAQKTTIAALRHLKQ 424
                            *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.4991983IPR001356Homeobox domain
SMARTSM003892.8E-152187IPR001356Homeobox domain
CDDcd000863.28E-162484No hitNo description
SuperFamilySSF466891.33E-162486IPR009057Homeodomain-like
PfamPF000465.4E-162582IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-182682IPR009057Homeodomain-like
CDDcd146861.93E-676115No hitNo description
PROSITE profilePS5084824.285206406IPR002913START domain
CDDcd088751.15E-68210426No hitNo description
Gene3DG3DSA:3.30.530.202.6E-22214406IPR023393START-like domain
SMARTSM002341.7E-46215425IPR002913START domain
SuperFamilySSF559616.04E-38216427No hitNo description
PfamPF018529.7E-51216424IPR002913START domain
PfamPF086708.4E-50753899IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 900 aa     Download sequence    Send to blast
MAMVVSGKEL GKGLQQAAAM DSGKYVRYTP EQVEALERVY SECPKPSSLR RQQLIRECPI  60
LSNIEPKQIK VWFQNRRCRE KQRKEASRLQ TVNRKLTAMN KLLMEENDRL QKQVSQLVYE  120
NGYMRQQLHS VSLHAYMFLI PCSIKNVPLT LSYFTIPYNI HFCLGLNILF MNIQPSVATD  180
ASCESVVTSG QHHHQQNPTS QHPERDANNP AGLLAIAEET LAEFLSKATG TAVEWVQMVG  240
MKPGPDSIGI VAVSHNCGGV AARACGLVSL EPTKVAEVLK DRPSWYRDCR CLDVLTVIPT  300
GNGGNIELTY MQTYAPTTLA AARDFWTLRY TTALEDGSLV ICERSLTPAT GGPTGPAATN  360
FVRAEMLSSG YLIRPCEGGG SMIHIVDHVD LDPWSVPEVL RPLYESPKIL AQKTTIAALR  420
HLKQIAQETS GEVPFGGGRQ PAVLRAFSQR LSRGFNDAVN GFADDGWSLL GSDGVEDVTI  480
AINSSPNKLF GSHVNPSAIY STLGGGVLCA KASMLLQNVP PAILVRFLRE HRSEWADCGV  540
DAYSAASLRT GSYAVPGVRP NSGFLGSQVI LPLAHTAENE EFLEVIRLEG NGFNQDDVIL  600
SRDMYLLQLC SGVEENAVGA CAQLVFAPID ESFDDNLPLL PSGFRVIPLD PKTDSPATTR  660
TLDLASTLEV GSGATSRSVN ETASTTYNLR SVLTIAFQFT YENHLRDSVA AMARQYVRSV  720
VTSVQRVAMA IAPSRPGCQI GVKHPPGSPE AHTLARWISQ SYRVHTGAEL FQVDSQANDS  780
SLKLLWHHSD AIMCCSLKAS HCVAPVFTFS NQAGLDMLET TLIALQDITL EKILDDNGRK  840
VLCSEFPKIM QQGFAHLPAG ICLSSMGRPA SYEQAVAWKV LDEDDSPHCL AFMFVNWSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397717.10.0PREDICTED: homeobox-leucine zipper protein HOX32-like
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0SSU80.0M0SSU8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P28360_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein